PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.E04119.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MYB
Protein Properties Length: 265aa    MW: 28471.5 Da    PI: 4.7409
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.E04119.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding482.9e-152572148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l   ++ +G  tW+++ +  g++R++k+c++rw +yl
   Pahal.E04119.1 25 KGLWSPEEDERLFAQITYHGVSTWSSVGQLAGLRRSGKSCRLRWMNYL 72
                     678*******************************************97 PP

2Myb_DNA-binding44.53.5e-1480121346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      + ++ E+e ++ + + lG++ W+tIa++m+ gRt++++k++w++
   Pahal.E04119.1  80 PISKREEEVIISLQQSLGNR-WSTIAARMP-GRTDNEIKNYWNS 121
                      56889***************.*********.***********95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.0792072IPR017930Myb domain
SMARTSM007178.7E-102474IPR001005SANT/Myb domain
SuperFamilySSF466895.62E-2724119IPR009057Homeodomain-like
PfamPF002492.9E-122572IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-192679IPR009057Homeodomain-like
CDDcd001673.60E-82872No hitNo description
PROSITE profilePS5129421.65673127IPR017930Myb domain
SMARTSM007171.6E-1277125IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-2380127IPR009057Homeodomain-like
PfamPF002491.5E-1180121IPR001005SANT/Myb domain
CDDcd001679.29E-1080120No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MVRKPSHGDS TGAGNGCTEA AKERKGLWSP EEDERLFAQI TYHGVSTWSS VGQLAGLRRS  60
GKSCRLRWMN YLRPDLKKEP ISKREEEVII SLQQSLGNRW STIAARMPGR TDNEIKNYWN  120
SRIRKRLNDA AKAGRDDGAG TEPAPAGEEK VEVEPANAAT EAGPMPIPAR FPVFACQMLD  180
GGVGGGGISS AGSGSGENTP STTSSTQQNS GEESEASVGD SNMIHFLLFD DLDYPADLVM  240
DVPGAMDAWE SELYPANSIS SLNY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-242512727128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9715591e-143EU971559.1 Zea mays clone 367166 anthocyanin regulatory C1 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004968332.11e-140PREDICTED: transcription factor MYB82-like
TrEMBLK3XL221e-140K3XL22_SETIT; Uncharacterized protein
STRINGSi002595m1e-140(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP87032545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.13e-48myb domain protein 86